PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10008083m
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family SBP
Protein Properties Length: 349aa    MW: 38507.1 Da    PI: 9.5628
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10008083mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP117.18.8e-37194271178
                      --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
              SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                      +Cq+egC+adls+ak+y rrhkv e+hska++v+++gl+qrf qqCsrfh lsefD++krsCr+rLa+hn+rrrk ++
  Thhalv10008083m 194 RCQAEGCNADLSHAKHYPRRHKVWEFHSKASTVVAAGLSQRFSQQCSRFHLLSEFDNGKRSCRKRLADHNRRRRKCNQ 271
                      6*************************************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.109.1E-32190256IPR004333Transcription factor, SBP-box
PROSITE profilePS5114128.769192269IPR004333Transcription factor, SBP-box
SuperFamilySSF1036129.16E-34193272IPR004333Transcription factor, SBP-box
PfamPF031103.1E-26195268IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009554Biological Processmegasporogenesis
GO:0009556Biological Processmicrosporogenesis
GO:0048653Biological Processanther development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 349 aa     Download sequence    Send to blast
MLDYEWDNPS AIMLSGEEHR HHHQEADPTR AMSIFDPTHH HSNSPYSNIS PPLLSSSFSN  60
QHHLTTVYGH HHHHHITTTN QFHHHSLYDP RTTTTHNNPY ASSDSIYHSS AAASALFSFD  120
HQITGSGSAG SSSYNFLIPK TEVDVVSRPL DFTSSNRIGL NLGAALTSPP PTTTSRLYRR  180
SRPGELGNSL STPRCQAEGC NADLSHAKHY PRRHKVWEFH SKASTVVAAG LSQRFSQQCS  240
RFHLLSEFDN GKRSCRKRLA DHNRRRRKCN QSASIAHDSA KSTPADITTT PKSSNDSGIN  300
RKSSSSPSNA LLSPPTISLE CFRQRQFQTT ASSSTSASSS SNSMFFSS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-241952681184squamosa promoter binding protein-like 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00090SELEXTransfer from AT1G02065Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009118853.11e-146PREDICTED: squamosa promoter-binding-like protein 8
RefseqXP_013730442.11e-146PREDICTED: squamosa promoter-binding-like protein 8
SwissprotQ8GXL31e-115SPL8_ARATH; Squamosa promoter-binding-like protein 8
TrEMBLA0A078HML51e-142A0A078HML5_BRANA; BnaCnng09040D protein
STRINGBra033221.1-P1e-126(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM70102743
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G02065.14e-98squamosa promoter binding protein-like 8